PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00695.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 390aa    MW: 41636.9 Da    PI: 7.131
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00695.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161462148
                                  TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  Zmw_sc00695.1.g00060.1.sm.mk 14 KGPWSPEEDVKLKAYIEEHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                                  79*********************************************97 PP

2Myb_DNA-binding39.41.4e-1269111246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   g +T+eE+ ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc00695.1.g00060.1.sm.mk  69 GDFTEEEEHIICRLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                                   789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.343962IPR017930Myb domain
SuperFamilySSF466891.21E-2611109IPR009057Homeodomain-like
SMARTSM007177.4E-131364IPR001005SANT/Myb domain
PfamPF002491.8E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-241569IPR009057Homeodomain-like
CDDcd001677.61E-101662No hitNo description
PROSITE profilePS5129422.22963117IPR017930Myb domain
SMARTSM007178.5E-1167115IPR001005SANT/Myb domain
PfamPF002492.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2370117IPR009057Homeodomain-like
CDDcd001672.03E-771111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDVKLKAYIE EHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEEHIIC RLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
QAPSRRSRAA NQGPYLSTAA AGGNMCRNTS GVSNSAAMAT QALSASALER IQLHMRLQGL  180
YGAFGCAAAG DTGAGANTPQ YWPKLESLLE SKLQLPATEP VDAVATTVNV HQPQHVVDQS  240
LAVAAGRAVE TEQLGSIGAA TYNLTPCSFE RPSKPEFCSP SAATEADASG LMVNGGIYGA  300
GFGPEHDEIY DFLYNKYGSM LGAVGAQGGG HIIPSLPELQ CPDGAAAIVG ADEKFSTWTA  360
TSCDYGQFQG NPIGGGGMQD YALGGYDQWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660926.11e-154PREDICTED: uncharacterized protein LOC101760334
SwissprotQ9FKL23e-89MYB36_ARATH; Transcription factor MYB36
TrEMBLK3YT201e-155K3YT20_SETIT; Uncharacterized protein
STRINGSi017415m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412